Anti-Human IL-1 beta Rabbit Recombinant Antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Human IL-1 beta Rabbit Recombinant Antibody, PBS Only (98142-1-PBS)

• 

  FC experiment of human PBMCs using 98142-1-RR (same clone as 98142-1-PBS)

  1x10^6 untreated or IFN gamma, LPS and Brefeldin A treated human PBMCs were intracellularly stained with 0.25 ug Anti-Human IL-1 beta Rabbit Recombinant Antibody (98142-1-RR, Clone: 240902A3) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98142-1-PBS in a different storage buffer formulation.

• 

  FC experiment of human PBMCs using 98142-1-RR (same clone as 98142-1-PBS)

  1x10^6 IFN gamma, LPS and Brefeldin A treated human PBMCs were intracellularly stained with 0.25 ug Anti-Human IL-1 beta Rabbit Recombinant Antibody (98142-1-RR, Clone: 240902A3) (red) or Isotype Control (blue) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). 1x10^6 unstimulated human PBMCs were intracellularly stained with 0.25 ug Anti-Human IL-1 beta Rabbit Recombinant Antibody (98142-1-RR, Clone: 240902A3) (black, dashed) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98142-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 98142-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98142-1-RR against Human IL-1 beta were performed. The affinity constant is 4.98 nM.

IL-1 beta Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98142-1-PBS

Clone No.240902A3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

Synonyms

240902A3, Catabolin, IL 1, IL 1 beta, IL1 beta

---

Product Information

98142-1-PBS targets IL-1 beta in FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0286

  Product name: Recombinant Human IL-1 Beta protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: N-6*HIS

  Domain: 117-269 aa of BC008678

  Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

• Full Name: interleukin 1, beta
• Calculated Molecular Weight: 269 aa, 31 kDa
• GenBank Accession Number: BC008678
• Gene Symbol: IL1B
• Gene ID (NCBI): 3553
• ENSEMBL Gene ID: ENSG00000125538
• RRID: AB_3672288
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P01584
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Interleukin-1 is a pro-inflammatory cytokine with multiple biological effects. The IL-1 gene family encodes three proteins: IL-1α, IL-1β and their naturally occurring inhibitor Il-1RN. IL-1 Beta(IL-1β), mainly produced by blood monocytes and tissue macrophages, has been implicated in mediating both acute and chronic inflammation. IL-1β is known to be involved in a variety of cellular activities, including cell proliferation, differentiation and apoptosis. IL-1β is emerging as a key mediator of carcinogenesis that characterizes host-environment interactions.