Anti-Human IL-10RB Rabbit Recombinant Antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Human IL-10RB Rabbit Recombinant Antibody, PBS Only (98292-1-PBS)

IL-10RB Uni-rAb^® Recombinant Antibody for FC

Cat No. 98292-1-PBS Copied!

Clone No. 242302D2

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

IL10RB, 242302D2, CDW210B, CRF2 4, CRF2-4

• 

  FC experiment of human PBMCs using 98292-1-RR (same clone as 98292-1-PBS)

  1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human IL-10RB Rabbit RecAb (98292-1-RR, Clone: 242302D2) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were co-stained with CoraLite® Plus 647 Anti-Human HLA-DR (L243) Mouse IgG2a Recombinant Antibody (CL647-65560, Clone: L243). Cells were not fixed. This data was developed using the same antibody clone with 98292-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of human PBMCs using 98292-1-RR (same clone as 98292-1-PBS)

  1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human IL-10RB Rabbit RecAb (98292-1-RR, Clone:242302D2) (red) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98292-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for IL-10RB in ?

Chat with Able

---

Product Information

98292-1-PBS targets IL-10RB in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3446

  Product name: Recombinant Human IL-10RB protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 20-220 aa of BC001903

  Sequence: MVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPS

• Full Name: interleukin 10 receptor, beta
• Calculated Molecular Weight: 37 kDa
• GenBank Accession Number: BC001903
• Gene Symbol: IL10RB
• Gene ID (NCBI): 3588
• RRID: AB_3745958
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q08334
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Interleukin-10 (IL-10) is an anti-inflammatory cytokine that plays a critical role in maintaining immune system balance. IL-10 signals through a receptor complex consisting of two molecules of the IL-10R alpha-chain (IL-10RA) and two molecules of the accessory IL-10R beta-chain (IL-10RB) (PMID: 22236434). IL-10RA and IL-10RB are members of the type II cytokine receptor family. IL-10RB, also known as IL-10R2 or CDw210b, is the signaling subunit of the IL-10R complex and is constitutively expressed in a variety of cell types (PMID: 24507158). Binding of IL-10 to the IL-10R complex leads to JAK1- and TYK2-mediated phosphorylation of STAT3 (PMID: 11244051; 10433356). IL-10RB is also shared by several other cytokines, including IL22, IL-26, IFN-γ, IL-28A/B and IL29 (PMID: 22236434).