IL-12A/IL-12 p35 Recombinant monoclonal antibody, PBS Only (Detector)

IL-12A/IL-12 p35 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 85754-2-PBS
Clone No.242887A3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

IL-12, CLMF, CLMF p35, IL 12 subunit p35, IL 12A

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85754-2-PBS targets IL-12A/IL-12 p35 as part of a matched antibody pair:

MP02056-1: 85754-3-PBS capture and 85754-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3341

Product name: Recombinant Human IL12A protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 23-219 aa of BC104982

Sequence: RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

Predict reactive species
Full Name interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35)
Calculated Molecular Weight 25 kDa
Observed Molecular Weight35 kDa
GenBank Accession NumberBC104982
Gene Symbol IL-12A
Gene ID (NCBI) 3592
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP29459
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

IL-12A (Interleukin-12A) is a subunit of the cytokine IL-12, which is also known as IL-12 p35. IL-12 is a heterodimeric cytokine composed of two subunits: IL-12A (p35) and IL-12B (p40). This cytokine plays a crucial role in the immune response, particularly in the activation and differentiation of T cells and natural killer (NK) cells.

Loading...
||
New chat

Able

正在加载,请稍候...