IL-12A/IL-12 p35 Recombinant monoclonal antibody

• 

  WB analysis using 85754-4-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85754-4-RR (IL-12A/IL-12 p35 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of THP-1 using 85754-4-RR

  Immunofluorescent analysis of (4% PFA) fixed IFN gamma and LPS treated THP-1 cells using IL-12A/IL-12 p35 antibody (85754-4-RR, Clone: 242887G5 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

IL-12A/IL-12 p35 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 85754-4-RR

Clone No.242887G5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

IL-12, CLMF, CLMF p35, IL 12 subunit p35, IL 12A

---

Tested Applications

• Positive WB detected in: Recombinant protein
• Positive IF/ICC detected in: IFN gamma and LPS treated THP-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85754-4-RR targets IL-12A/IL-12 p35 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3341

  Product name: Recombinant Human IL12A protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 23-219 aa of BC104982

  Sequence: RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

• Full Name: interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35)
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC104982
• Gene Symbol: IL-12A
• Gene ID (NCBI): 3592
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P29459
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IL-12A (Interleukin-12A) is a subunit of the cytokine IL-12, which is also known as IL-12 p35. IL-12 is a heterodimeric cytokine composed of two subunits: IL-12A (p35) and IL-12B (p40). This cytokine plays a crucial role in the immune response, particularly in the activation and differentiation of T cells and natural killer (NK) cells. This antibody recognizes IL-12A and IL-12 P70, which consists of IL-12A and B, but does not recognize IL-12B.