CoraLite® Plus 488-conjugated IL-12/IL-23 p40 Monoclonal antibody

IL-12/IL-23 p40 Monoclonal Antibody for
Cat No. CL488-66288
Clone No.4B2A8

Host / Isotype

Mouse / IgG2a

Reactivity

human, pig

Applications

CLMF, CLMF p40, CLMF2, IL 12 subunit p40, IL 12B, IL-12/IL-23 p40, IL12B, IL-12B, Interleukin 12 subunit beta, NKSF, NKSF2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL488-66288 targets IL-12/IL-23 p40 in applications and shows reactivity with human, pig samples.

Tested Reactivity human, pig
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag21429

Product name: Recombinant human IL-12B protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 29-328 aa of BC067498

Sequence: DVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

Predict reactive species
Full Name interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40)
Calculated Molecular Weight 328 aa, 37 kDa
Observed Molecular Weight 37 kDa
GenBank Accession NumberBC067498
Gene Symbol IL12B
Gene ID (NCBI) 3593
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP29460
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

IL-12 and IL-23 are heterodimeric cytokines that share a common p40 subunit (PMID: 11114383). IL-12 is composed of the IL-12 p40 subunit linked to the IL-12 p35 subunit, and the heterodimer signals through the IL-12 receptor (IL-12R), which comprises the IL-12Rβ1 and IL-12Rβ2 subunits. IL-23 is composed of the IL-23 p19 subunit and the IL-12 p40 (IL-12/23p40) subunit, which signals through IL-23R and IL-12Rβ1 (PMID: 11114383; 26121196 ). IL-12/IL-23 p40 also exists as a monomer and as a homodimer which can act as a potent IL-12 antagonist (PMID: 8958912; 18783467). IL-12/IL-23 p40 is produced by antigen-presenting cells, such as dendritic cells (DCs), monocytes, macrophages, neutrophils and, to a lesser extent, B cells (PMID: 20476918).

Loading...
||
New chat Able
正在加载,请稍候...