Anti-Mouse IL-13RA2 Rabbit Recombinant Antibody

• 

  FC experiment of Transfected HEK-293T using 98407-3-RR

  1x10^6 HEK-293T cells (left) and IL-13RA2-transfected HEK-293T cells (right) were surface stained with 0.25 ug Anti-Mouse IL-13RA2 Rabbit RecAb (98407-3-RR, Clone: 242742C4) and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed.

• 

  FC experiment of Transfected HEK-293T using 98407-3-RR

  1x10^6 HEK-293T cells (left) and IL-13RA2-transfected HEK-293T cells (right) were surface stained with 0.25 ug Anti-Mouse IL-13RA2 Rabbit RecAb (98407-3-RR, Clone: 242742C4) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-2-RR, Clone: 240953A11) (blue), and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed.

IL-13RA2 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98407-3-RR

Clone No.242742C4

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

CD213a2, IL-13 receptor subunit alpha-2, IL-13R subunit alpha-2, Il13ra2, IL-13R-alpha-2

---

Tested Applications

• Positive FC detected in: Transfected HEK-293T cells

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98407-3-RR targets IL-13RA2 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3118

  Product name: Recombinant Mouse IL-13RA2 protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 22-334 aa of NM_008356.4

  Sequence: LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVIEKFKGCTLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWIEASYGISDEGSLETKIQDMKCIYYNWQYLVCSWKPGKTVYSDTNYTMFFWYEGLDHALQCADYLQHDEKNVGCKLSNLDSSDYKDFFICVNGSSKLEPIRSSYTVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPRCYTYEIVIREDDISWESATDKNDMKLKRRANESEDLCFFVRCKVNIYCADDGIWSEWSEEECWEGYTGPDSK

• Full Name: interleukin 13 receptor, alpha 2
• Calculated Molecular Weight: 44 kDa
• GenBank Accession Number: NM_008356.4
• Gene Symbol: Il13ra2
• Gene ID (NCBI): 16165
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O88786-1
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

IL-13RA2, also named as IL-13R and CD213a2, belongs to the type I cytokine receptor family. It binds as a monomer with high affinity to interleukin-13 (IL13), but not to interleukin-4 (IL4). IL-13RA2 lacks the cytoplasmic domain for signaling, indicating that it acts as a decoy receptor. IL-13RA2 gene polymorphisms have been associated with systemic sclerosis (PMID: 16981293). Overexpression of IL-13RA2 gene has been reported in several types of cancer, including melanoma, lung cancer, and brain tumor, which makes it a potential immunotherapeutic target (PMID: 19895199; 24970476; 24021875).