Anti-Rat IL-17A Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Rat IL-17A Rabbit Recombinant Antibody (98564-1-RR)

IL-17A Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98564-1-RR Copied!

Clone No. 250413G7

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

FC (Intra)

Synonyms

Il17a, Interleukin 17A

• 

  FC experiment of Transfected HEK-293T using 98564-1-RR

  1x10^6 HEK-293T cells (left) or IL-17A transfected HEK-293T cells (right) were intracellularly stained with 0.25 ug Anti-Rat IL-17A Rabbit RecAb (98564-1-RR, Clone: 250413G7) and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of Transfected HEK-293T using 98564-1-RR

  1x10^6 HEK-293T cells (left) and IL-17A transfected HEK-293T cells (right) were intracellularly stained with 0.25 ug Anti-Rat IL-17A Rabbit RecAb (98564-1-RR, Clone: 250413G7) (red) or Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue), and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 98564-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98564-1-RR against Rat IL-17A were performed. The affinity constant is below 1 pM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for IL-17A in ?

Chat with Able

---

Tested Applications

• Positive FC (Intra) detected in: Transfected HEK-293T cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98564-1-RR targets IL-17A in FC (Intra) applications and shows reactivity with rat samples.

• Tested Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3339

  Product name: Recombinant Rat IL-17A protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 18-150 aa of

  Sequence: AVLIPQSSVCPNAEANNFLQNVKVNLKVINSLSSKASSRRPSDYLNRSTSPWTLSRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS

• Full Name: similar to Interleukin-17 precursor (IL-17) (Cytotoxic T lymphocyte-associated antigen 8) (CTLA-8)
• Calculated Molecular Weight: 17kDa
• Gene Symbol: LOC301289
• Gene ID (NCBI): 301289
• RRID: AB_3746182
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q61453
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

IL-17A, also named as IL-17, is a proinflammatory cytokine. IL-17, synthesized only by memory T cells and natural killer cells, has pleiotropic effects, mainly in the recruitment and activation of neutrophils. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. The IL-17 receptor is a type I transmembrane protein, that is widely expressed on epithelial cells, fibroblasts, B and T cells, and monocytic cells. In psoriatic skin lesions, both Th17 cells and their downstream effector molecules, e.g. IL-17 and IL-22, are highly increased.