IL-17B Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• IL-17B Recombinant monoclonal antibody (87094-1-RR)

• 

  WB analysis of Recombinant protein using 87094-1-RR

  Mouse IL-17B Recombinant protein (Cat No. Eg4299) was subjected to SDS PAGE followed by western blot with 87094-1-RR (Il17b antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 87094-1-RR

  Untransfected and mouse IL-17B B-transfected HEK-293 cells were subjected to SDS PAGE followed by western blot with 87094-1-RR (Il17b antibody) at a dilution of 1:2000, incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 87094-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87094-1-RR against Mouse IL-17B were performed. The affinity constant is 2.52 nM.

IL-17B Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87094-1-RR

Clone No.251217F4

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, ELISA

Synonyms

Cytokine CX1, Cytokine-like protein ZCYTO7, Il17b, Interleukin-17B, Neuronal interleukin-17-related factor

---

Tested Applications

• Positive WB detected in: Recombinant protein, Transfected with Mouse Il17b Transfected HEK-293T cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87094-1-RR targets IL-17B in WB, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2785

  Product name: recombinant mouse Il17b protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 23-180 aa of NM_019508.1

  Sequence: RNTKGKRKGQGRPSPLAPGPHQVPLDLVSRVKPYARMEEYERNLGEMVAQLRNSSEPAKKKCEVNLQLWLSNKRSLSPWGYSINHDPSRIPADLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPQPPRPGPCRQRVVMETIAVGCTCIF

• Full Name: interleukin 17B
• Calculated Molecular Weight: 20 kDa
• GenBank Accession Number: NM_019508.1
• Gene Symbol: Il17b
• Gene ID (NCBI): 56069
• RRID: AB_3745333
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9QXT6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The interleukin (IL)-17 superfamily, a relatively new family of cytokines, consists of six ligands (from IL-17A to IL-17F), which bind to five receptor subtypes (from IL-17RA to IL-17RE) and induce downstream signaling. IL-17B was originally described as increased during intestinal inflammation. Moreover, it stimulates TNF-α and IL-1β production by the human monocytic leukemia THP-1 cells and promotes neutrophil migration upon intraperitoneal administration, suggesting a pro-inflammatory role. More recent findings strongly suggest a role for the IL-17B/IL-17RB pathway in tumorigenesis.