IL-17F Monoclonal antibody, PBS Only

IL-17F Monoclonal Antibody for WB, Indirect ELISA
Cat No. 60245-1-PBS
Clone No.6H5F10

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, Indirect ELISA

IL17F, Cytokine ML 1, Cytokine ML-1, IL 17F, interleukin 17F

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60245-1-PBS targets IL-17F in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag16310

Product name: Recombinant human IL-17F protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-163 aa of BC070124

Sequence: MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQ

Predict reactive species
Full Name interleukin 17F
Calculated Molecular Weight 163 aa, 18 kDa
Observed Molecular Weight 37 kDa
GenBank Accession NumberBC070124
Gene Symbol IL-17F
Gene ID (NCBI) 112744
RRIDAB_2881367
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ96PD4
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The interleukin 17 (IL-17) family of cytokines contains 6 structurally related cytokines, IL-17A, IL-17B, IL-17C, IL-17D, IL-17E and IL-17F. IL-17 family plays crucial roles in host defense against microbial organisms and in the development of inflammatory diseases. IL-17A is a pro-inflammatory cytokine that also has the capacity to promote angiogenesis and osteoclastogenesis. IL-17F shares the highest homology with IL-17A and signals via a receptor composed by the IL-17RA and IL-17RC subunits. IL-17A and IL-17F can form IL-17A/A or IL-17F/F homodimers, IL-17A/F heterodimers are also formed. IL-17A and IL-17F, produced by the Th17 CD4(+) T cell lineage, have been linked to a variety of inflammatory and autoimmune conditions. IL-17F levels are elevated in sera and lesional psoriatic skin compared to non-lesional tissue. IL-17F also has been implicated in the development of neutrophilic airway inflammation.

Loading...
||
New chat Able
正在加载,请稍候...