Mouse IL-17RB Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85961-1-RR (same clone as 85961-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85961-1-RR (IL-17RB antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85961-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Transfected HEK-293T using 85961-1-RR (same clone as 85961-1-PBS)

  Untransfected HEK-293T cells or mouse IL-17RB-transfected HEK-293T cells were subjected to SDS PAGE followed by western blot with 85961-1-RR (IL-17RB antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85961-1-PBS in a different storage buffer formulation.

IL-17RB Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85961-1-PBS

Clone No.242967E11

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Evi27, IL-17 receptor B, IL-17 receptor homolog 1, IL-17B receptor, Il17br

---

Product Information

85961-1-PBS targets IL-17RB in WB, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2798

  Product name: recombinant mouse Il17rb protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 18-286 aa of NM_019583.3

  Sequence: REPTIQCGSETGPSPEWMVQHTLTPGDLRDLQVELVKTSVAAEEFSILMNISWILRADASIRLLKATKICVSGKNNMNSYSCVRCNYTEAFQSQTRPSGGKWTFSYVGFPVELSTLYLISAHNIPNANMNEDSPSLSVNFTSPGCLNHVMKYKKQCTEAGSLWDPDITACKKNEKMVEVNFTTNPLGNRYTILIQRDTTLGFSRVLENKLMRTSVAIPVTEESEGAVVQLTPYLHTCGNDCIRREGTVVLCSETSAPIPPDDNRRMLGG

• Full Name: interleukin 17 receptor B
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 67 kDa
• GenBank Accession Number: NM_019583.3
• Gene Symbol: Il17rb
• Gene ID (NCBI): 50905
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9JIP3-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IL-17RB is a transmembrane protein that belongs to the IL-17 receptor family. IL-17RB has a SEFIR cytoplasmic domain implicated in homotypic dimerization and recruitment of signaling proteins (shared with IL-17RA) and a TRAF6-binding domain (not found in IL-17RA). IL-17RB is expressed in various endocrine tissues and epithelial cells in different organs such as kidney, liver, and mucosal tissues. The IL-17B/IL-17RB pathway is considered as a signaling cascade that promotes cancer cell survival, proliferation and migration. The pro-tumor functions associated with the IL 17B/IL-17RB pathway are diverse and complex because they involve mechanisms that act directly on tumor cells, and also indirect mechanisms that lead to tumor microenvironment remodeling.