IL-17RC Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• IL-17RC Polyclonal antibody, PBS Only (15648-1-PBS)

• 

  WB analysis using 15648-1-AP (same clone as 15648-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15648-1-AP (IL-17RC antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15648-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 15648-1-AP (same clone as 15648-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 15648-1-AP (IL17RC antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15648-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 15648-1-AP (same clone as 15648-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15648-1-AP (IL17RC antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15648-1-PBS in a different storage buffer formulation.

IL-17RC Polyclonal Antibody for WB, Indirect ELISA

Cat No. 15648-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

IL17RC, IL-17 receptor C, IL17 RL, IL17RL, IL-17RL

---

Product Information

15648-1-PBS targets IL-17RC in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8190

  Product name: Recombinant human IL-17RC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC006411

  Sequence: MPVPWFLLSLALGRSPVVLSLERLVGPQDATHCSPGLSCRLWDSDILCLPGDIVPAPGPVLAPTHLQTELVLRCQKETDCDLCLRVAVHLAVHGHWEEPEDEEKFGGAADSGVEEPRNASLQAQVVLSFQAYPTARCVLLEVQVPAALVQFGQSVGSVVYDCFEAALGSEVRIWSYTQPRYEKELNHTQQLPALPWLNVSADGDNVHLVLNVSEEQHFGLSLYWNQVQGPPKPRWHKNLTGPQIITLNHTDLVPCLCIQVWPLEPDSVRTNICPFREDPRAHQNLWQAARLRLLTLQSWLLDAPCSLPAEAALCWRAPGGDPCQPLVPPLSWENVTVDKVLEFPLLKGHP

• Full Name: interleukin 17 receptor C
• Calculated Molecular Weight: 791aa,86 kDa; 538aa,59 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC006411
• Gene Symbol: IL-17RC
• Gene ID (NCBI): 84818
• RRID: AB_2296016
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NAC3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The IL-17 family has five receptors: IL-17RA (or IL-17R), IL-17RB (or IL-17Rh1), IL-17RC (or IL-17RL), IL-17RD and IL-17RE. IL-17RC is a 720-amino acid type I transmembrane protein with a 20-amino acid signal peptide, a 447-amino acid N-terminal extracellular domain, a 21-amino acid hydrophobic α-helical transmembrane domain, and a 232-amino acid intracellular domain(PMID: 18928529). IL17RC is widely expressed in nonleukocyte tissues and forms a heteromeric receptor for IL17 with IL17R(PMID: 16785495).