Mouse IL-18 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Mouse IL-18 Recombinant monoclonal antibody, PBS Only (87348-2-PBS)

IL-18 Uni-rAb^® Recombinant Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 87348-2-PBS

Clone No.252154A6

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

IFN-gamma-inducing factor, Igif, IL-1 gamma, Il18, Interferon gamma-inducing factor

• 

  WB analysis using 87348-2-RR (same clone as 87348-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87348-2-RR (IL-18 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87348-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse spleen using 87348-2-RR (same clone as 87348-2-PBS)

  IP result of anti-IL-18 (IP:87348-2-RR, 4ug; Detection:87348-2-RR 1:1500) with mouse spleen tissue lysate 2000 ug. This data was developed using the same antibody clone with 87348-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse spleen using 87348-2-RR (same clone as 87348-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 87348-2-RR (IL-18 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87348-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse spleen using 87348-2-RR (same clone as 87348-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 87348-2-RR (IL-18 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87348-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 87348-2-RR

  Biolayer interferometry (BLl) kinetic assays of 87348-2-RR against Mouse IL-18 were performed. The affinity constant is 2.55 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

87348-2-PBS targets IL-18 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4455

  Product name: Recombinant Mouse IL-18 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 1-192 aa of NM_008360.1

  Sequence: MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS

• Full Name: interleukin 18
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: NM_008360.1
• Gene Symbol: Il18
• Gene ID (NCBI): 16173
• RRID: AB_3745483
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P70380
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IL-18 is a proinflammatory cytokine involved in the development of Th1 cells and in immune response. It can stimulate the NK cells and certain T cells to release IFN gamma, which plays an important role in activating the macrophages or other cells. IL-18 has been demonstrated to have the potential to enhance Fas ligand-mediated cytotoxicity, which is increased in PE and regulates placental apoptosis. IL-18 is synthesized as a 22 kDa precursor and then cleaved into a biologically active 18 kDa form. This antibody recognizes both the pre-IL18 and mature IL18 theoretically.