Anti-Mouse IL-18 Rabbit Recombinant Antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Mouse IL-18 Rabbit Recombinant Antibody, PBS Only (98846-3-PBS)

• 

  FC experiment of Transfected HEK-293T using 98846-3-RR (same clone as 98846-3-PBS)

  1x10^6 HEK-293T cells (left) or IL-18-transfected HEK-293T cells(right) were intracellularly stained with 0.25 ug Anti-Mouse IL-18 Rabbit RecAb (98846-3-RR, Clone: 252154A6) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019). This data was developed using the same antibody clone with 98846-3-PBS in a different storage buffer formulation.

• 

  FC experiment of Transfected HEK-293T using 98846-3-RR (same clone as 98846-3-PBS)

  1x10^6 HEK-293T cells (left) or IL-18-transfected HEK-293T cells(right) were intracellularly stained with 0.25 ug Anti-Mouse IL-18 Rabbit RecAb (98846-3-RR, Clone: 252154A6) (red) or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019). This data was developed using the same antibody clone with 98846-3-PBS in a different storage buffer formulation.

• 

  FC experiment of Hepa 1-6 using 98846-3-RR (same clone as 98846-3-PBS)

  1x10^6 Hepa 1-6 cells were intracellularly stained with 0.25 ug Anti-Mouse IL-18 Rabbit RecAb (98846-3-RR, Clone: 252154A6) (red) or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019). This data was developed using the same antibody clone with 98846-3-PBS in a different storage buffer formulation.

IL-18 Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98846-3-PBS

Clone No.252154A6

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Synonyms

IFN-gamma-inducing factor, Igif, IL-1 gamma, Il18, Interferon gamma-inducing factor

---

Product Information

98846-3-PBS targets IL-18 in FC (Intra) applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4455

  Product name: Recombinant Mouse IL-18 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 1-192 aa of NM_008360.1

  Sequence: MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS

• Full Name: interleukin 18
• Calculated Molecular Weight: 22 kDa
• GenBank Accession Number: NM_008360.1
• Gene Symbol: Il18
• Gene ID (NCBI): 16173
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P70380
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IL-18 is a proinflammatory cytokine involved in the development of Th1 cells and in immune response. It can stimulate the NK cells and certain T cells to release IFN gamma which plays an important role in activating the macrophages or other cells. IL-18 has been demonstrated to have the potential to enhance Fas ligand-mediated cytotoxicity, which is increased in PE and regulates placental apoptosis. IL-18 is synthesized as a 22 kDa precursor and then cleaved into a biologically activate 18 kDa form.