IL-1F6/IL-36 alpha Polyclonal antibody

• 

  IHC staining of human gliomas using 24173-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 24173-1-AP (IL-1F6 / IL-36α antibody at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human gliomas using 24173-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 24173-1-AP (IL-1F6 / IL-36α antibody at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human tonsillitis using 24173-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 24173-1-AP (IL-1F6/IL-36 Alpha antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

IL-1F6/IL-36 alpha Polyclonal Antibody for IHC, ELISA

Cat No. 24173-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

IL1F6, IL-36 Alpha, IL-36α, IL 1F6, IL-1F6

---

Tested Applications

• Positive IHC detected in: human tonsillitis tissue, human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 2 publications below

Product Information

24173-1-AP targets IL-1F6/IL-36 alpha in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21487

  Product name: Recombinant human IL-1F6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-158 aa of BC107043

  Sequence: MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF

• Full Name: interleukin 1 family, member 6 (epsilon)
• Calculated Molecular Weight: 158 aa, 18 kDa
• GenBank Accession Number: BC107043
• Gene Symbol: IL-1F6/IL-36 alpha
• Gene ID (NCBI): 27179
• RRID: AB_2879446
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UHA7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	J Cutan Pathol; IL-36α and IL-36γ expressions in the differential diagnosis of palmoplantar psoriasis and palmoplantar eczema: A retrospective histopathologic and immunohistochemical study.; Authors - Ozan Erdem
human	IHC	Exp Dermatol; Clinical Responses and Transcriptomic Analysis of Spesolimab in a Girl With Severe Dermatitis, Multiple Allergies and Metabolic Wasting Syndrome; Authors - Jinxiang Yang