Use Able AI chat for product recommendations

IL-1F6/IL-36 alpha Polyclonal antibody

IL-1F6/IL-36 alpha Polyclonal Antibody for IHC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

IL1F6, IL-36 Alpha, IL-36α, IL 1F6, IL-1F6

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for IL-1F6/IL-36 alpha in ?

Tested Applications

Positive IHC detected inhuman tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

24173-1-AP targets IL-1F6/IL-36 alpha in IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag21487

Product name: Recombinant human IL-1F6 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-158 aa of BC107043

Sequence: MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF

Predict reactive species
Full Name interleukin 1 family, member 6 (epsilon)
Calculated Molecular Weight 158 aa, 18 kDa
GenBank Accession NumberBC107043
Gene Symbol IL-1F6/IL-36 alpha
Gene ID (NCBI) 27179
RRIDAB_2879446
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UHA7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IL-1F6, also known as IL-36α (IL36A), is a pro-inflammatory member of the IL-1 cytokine family that is primarily expressed in skin and lymphoid tissues, with lower levels detected in fetal brain, trachea, stomach, and intestine. It is uniquely produced by monocytes, B cells, and T cells among the novel IL-1 family ligands, and its expression is markedly elevated in psoriatic plaques. Functionally, IL-36α signals through a heterodimeric receptor complex comprising IL-1Rrp2 (IL-36R) and IL-1RAcP, thereby activating NF-κB and MAPK signaling pathways to induce the production of inflammatory mediators such as IL-6, IL-8, and antimicrobial peptides including BD-2 and BD-3. As a key regulator of both innate and adaptive immunity, IL-36α plays a critical role in epithelial barrier defense and tissue inflammation, and its dysregulation has been implicated in inflammatory skin diseases, kidney disorders, and fibrotic conditions.

Protocols

Product Specific Protocols
IHC protocol for IL-1F6/IL-36 alpha antibody 24173-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The IL-1F6/IL-36 alpha Polyclonal antibody (Cat# 24173-1-AP) has 3 citations published in Experimental Dermatology, Frontiers in Oncology, and Journal of Cutaneous Pathology. All citations used IHC in human samples. Research fields span dermatology (severe dermatitis, palmoplantar psoriasis vs. eczema differential diagnosis) and oncology (IL-36-related gene prognosis in gastric cancer).

SpeciesApplicationTitle
humanIHC

Front Oncol

IL-36-related genes predict prognosis of gastric cancer

Authors - Ying Zhang
humanIHC

Exp Dermatol

Clinical Responses and Transcriptomic Analysis of Spesolimab in a Girl With Severe Dermatitis, Multiple Allergies and Metabolic Wasting Syndrome

Authors - Jinxiang Yang
humanIHC

J Cutan Pathol

IL-36α and IL-36γ expressions in the differential diagnosis of palmoplantar psoriasis and palmoplantar eczema: A retrospective histopathologic and immunohistochemical study.

Authors - Ozan Erdem
Loading...
||
New chat

Able™

正在加载,请稍候...