IL-1R1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• IL-1R1 Polyclonal antibody, PBS Only (27348-1-PBS)

• 

  WB analysis using 27348-1-AP (same clone as 27348-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27348-1-AP (IL-1R1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27348-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 27348-1-AP (same clone as 27348-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 27348-1-AP (IL-1R1 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27348-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 27348-1-AP (same clone as 27348-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 27348-1-AP (IL-1R1 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27348-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human appendicitis using 27348-1-AP (same clone as 27348-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 27348-1-AP (IL-1R1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27348-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human appendicitis using 27348-1-AP (same clone as 27348-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 27348-1-AP (IL-1R1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27348-1-PBS in a different storage buffer formulation.

IL-1R1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27348-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

IL1R1, IL 1R alpha, IL 1R 1, EC:3.2.2.6, D2S1473

---

Product Information

27348-1-PBS targets IL-1R1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25998

  Product name: Recombinant human IL-1R1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 18-336 aa of BC075063

  Sequence: LEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQK

• Full Name: interleukin 1 receptor, type I
• Calculated Molecular Weight: 569 aa, 65 kDa
• Observed Molecular Weight: 80 kDa, 60 kDa
• GenBank Accession Number: BC075063
• Gene Symbol: IL1R1
• Gene ID (NCBI): 3554
• RRID: AB_3085949
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P14778
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IL-1R1 (IL-1 receptor type 1, also known as p80, IL-1R-alpha or CD121a) is a 80 kDa transmembrane glycoprotein and a member of the interleukin-1 receptor family (PMID: 35163653; 29248002). It is a receptor for IL-1α, IL-1β, and interleukin-1 receptor antagonist (IL-1Ra). IL-1α and IL-1β interact with the extracellular domain of IL-1R1, triggering the recruitment of an accessory receptor, the IL-1RAcP, resulting in a functional receptor complex that initiates IL-1R1 signaling cascades (PMID: 35163653). IL-1Ra competes with active IL-1 and blocks binding to their common activating receptor IL-1R1 and, thus, inhibits IL-1 signaling (PMID: 35332327; 11641511). It has been reported that IL-1R1 may also bind IL-38 (PMID: 29248002). IL-1R1 expression has been found in many cell types including T cells, macrophages, neutrophils, eosinophils, basophils, mast cells, fibroblasts, and endothelial cells. IL-1R1 can be released from the cell surface following proteolytic cleavage, generating a soluble form of 55-60 kDa (PMID: 17324958).