IL-1RA Recombinant monoclonal antibody, PBS Only

IL-1RA Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 84532-4-PBS
Clone No.241879B3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

IL 1ra, IL1RN, 241879B3, ICIL-1RA, IL 1RN

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84532-4-PBS targets IL-1RA in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1277

Product name: Recombinant human IL-1RA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-159 aa of BC009745

Sequence: MALETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE

Predict reactive species
Full Name interleukin 1 receptor antagonist
Calculated Molecular Weight 20 kDa
Observed Molecular Weight16-18 kDa
GenBank Accession NumberBC009745
Gene Symbol IL-1RA
Gene ID (NCBI) 3557
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP18510
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Interleukin-1 receptor antagonist (IL-1RA) is a critical member of the IL-1 family of cytokines, which plays a significant role in modulating inflammatory responses. IL-1RA exists in two main forms: a secreted form (sIL-1Ra) and an intracellular form (icIL-1Ra). The secreted form is produced by various cells including monocytes, macrophages, neutrophils, and other cells, while the intracellular form is found in keratinocytes and other epithelial cells, as well as in monocytes and fibroblasts. IL-1RA is important in host defense against endotoxin-induced injury and is produced in numerous experimental animal models of disease, as well as in human autoimmune and chronic inflammatory diseases. It acts as an anti-inflammatory agent by maintaining the balance between pro-inflammatory IL-1α/β and its own anti-inflammatory effects.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Sarah (Verified Customer) (11-13-2025)

We wanted to use IL-1RA to see its ability as a therapeutic for damage caused to brain endothelial cells, we have not found that the IL-1RA has limited damage, but it did not cause any additional damage or toxicity in our cells so I rated 4/5. Interaction with sales reps and delivery times are 5/5!

  • Applications: Other
  • Primary Antibody Dilution: 1µg/mL
  • Cell Tissue Type: Brain endothelial cell line - hCMEC/D3
Loading...
||
New chat Able
正在加载,请稍候...