Mouse IL-1RA  Recombinant monoclonal antibody, PBS Only (Capture)

IL-1RA  Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 83335-4-PBS
Clone No.240208G5

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

Il1rn, IL-1RN, 240208G5, IL 1ra, IL-1RA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83335-4-PBS targets IL-1RA  as part of a matched antibody pair:

MP00353-2: 83335-4-PBS capture and 83335-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0685

Product name: Recombinant mouse IL-1RN protein

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 8-159 aa of NM_031167.5

Sequence: RPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ

Predict reactive species
Full Name interleukin 1 receptor antagonist
Calculated Molecular Weight18KD
Observed Molecular Weight18 kDa
GenBank Accession NumberNM_031167.5
Gene Symbol IL-1RA 
Gene ID (NCBI) 16181
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ542W1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Interleukin-1 receptor antagonist (IL-1RA) is a critical member of the IL-1 family of cytokines, which plays a significant role in modulating inflammatory responses. IL-1RA exists in two main forms: a secreted form (sIL-1Ra) and an intracellular form (icIL-1Ra). The secreted form is produced by various cells including monocytes, macrophages, neutrophils, and other cells, while the intracellular form is found in keratinocytes and other epithelial cells, as well as in monocytes and fibroblasts. IL-1RA is important in host defense against endotoxin-induced injury and is produced in numerous experimental animal models of disease, as well as in human autoimmune and chronic inflammatory diseases. It acts as an anti-inflammatory agent by maintaining the balance between pro-inflammatory IL-1α/β and its own anti-inflammatory effects.

Loading...
||
New chat Able
正在加载,请稍候...