Anti-Human IL-20RA Rabbit Recombinant Antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Human IL-20RA Rabbit Recombinant Antibody, PBS Only (98512-2-PBS)

IL-20RA Uni-rAb^® Recombinant Antibody for FC

Cat No. 98512-2-PBS Copied!

Clone No. 250321B10

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

IL20RA, CRF2 8, IL 20 receptor subunit alpha, IL 20R alpha, IL 20R1

• 

  FC experiment of Transfected CHO using 98512-2-RR (same clone as 98512-2-PBS)

  1x10^6 CHO cells or IL-20RA-transfected CHO cells were surface stained with 0.25 ug Anti-Human IL-20RA Rabbit RecAb (98512-2-RR, Clone: 250321B10) and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98512-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of Transfected CHO using 98512-2-RR (same clone as 98512-2-PBS)

  1x10^6 CHO cells or IL-20RA-transfected CHO cells were surface stained with 0.25 ug Anti-Human IL-20RA Rabbit RecAb (98512-2-RR, Clone: 250321B10) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98512-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of T47D using 98512-2-RR (same clone as 98512-2-PBS)

  1x10^6 T-47D cells were surface stained with 0.25 ug Anti-Human IL-20RA Rabbit RecAb (98512-2-RR, Clone: 250321B10) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98512-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for IL-20RA in ?

Chat with Able

---

Product Information

98512-2-PBS targets IL-20RA in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2780

  Product name: Recombinant Human IL-20RA protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 30-250 aa of NM_014432

  Sequence: VPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKDQSSEFKAK

• Full Name: interleukin 20 receptor, alpha
• Calculated Molecular Weight: 62 kDa
• GenBank Accession Number: NM_014432
• Gene Symbol: IL20RA
• Gene ID (NCBI): 53832
• RRID: AB_3746142
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UHF4-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Interleukin 20 receptor subunit alpha (IL-20RA) belongs to the type II cytokine receptor family. Upon binding to its ligands, such as interleukin (IL)-19, IL-20, and IL-24, IL-20RA can form a functional heterodimeric receptor with IL-20RB. IL-26, another IL-20RA ligand, requires IL-20RA and interleukin 10 receptor subunit beta (IL-10RB) for signaling (PMID: 25421700; 11163236; 15178681).