IL-22RA1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• IL-22RA1 Recombinant monoclonal antibody (87197-1-RR)

• 

  WB analysis of COLO 320 using 87197-1-RR

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 87197-1-RR (IL-22RA1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 87197-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87197-1-RR against Human IL-22RA1 were performed. The affinity constant is 14.4 nM.

IL-22RA1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87197-1-RR

Clone No.252165G11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

IL22RA1, CRF2 9, Cytokine receptor class-II member 9, IL 22 receptor subunit alpha 1, IL 22R alpha 1

---

Tested Applications

• Positive WB detected in: COLO 320 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87197-1-RR targets IL-22RA1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5132

  Product name: Recombinant human IL22RA1 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 16-228 aa of BC029273

  Sequence: HAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHDLFYHLELQVNRTYQMHLGGKQREYEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKTLPDRTWT

• Full Name: interleukin 22 receptor, alpha 1
• Calculated Molecular Weight: 574 aa, 63 kDa
• Observed Molecular Weight: 63 kDa
• GenBank Accession Number: BC029273
• Gene Symbol: IL-22RA1
• Gene ID (NCBI): 58985
• RRID: AB_3745401
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8N6P7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin-22 (IL-22), a member of the IL-10 family of cytokines, is important for the modulation of tissue responses during inflammation. IL-22 receptor is a heterodimer of the IL-10RB and IL-22RA1. IL-22RA1 belongs to the class II cytokine receptor family. It is expressed in a limited number of tissues including skin, colon, liver, lung, pancreas and kidney. The expression is lack in immune cells such as monocytes, T cells, and NK cells (PMID: 15308104). IL-22RA1 can also form a receptor for IL-20 and IL-24 with IL20RB (PMID: 23793061).