CoraLite® Plus 647-conjugated IL-22RA2 Polyclonal antibody

IL-22RA2 Polyclonal Antibody for
Cat No. CL647-22861

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

CRF2 10, CRF2 S1, CRF2X, IL 22 receptor subunit alpha 2, IL 22BP, IL 22R alpha 2, IL 22RA2, IL22BP, IL22RA2, IL-22RA2, Interleukin 22 binding protein, ZcytoR16

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL647-22861 targets IL-22RA2 in applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18854

Product name: Recombinant human IL-22RA2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-232 aa of BC125167

Sequence: MMPKHCFLGFLISFFLTGVAGTQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP

Predict reactive species
Full Name interleukin 22 receptor, alpha 2
Calculated Molecular Weight 263 aa, 31 kDa
Observed Molecular Weight 27 kDa
GenBank Accession NumberBC125167
Gene Symbol IL-22RA2
Gene ID (NCBI) 116379
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ969J5
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Interleukin-22 receptor subunit alpha-2 (IL22RA2, also known as CRF2-10) is a soluble member of the type II cytokine receptor family. Through binding to IL22, IL22RA2 prevents the interaction of IL22 with the functional IL22-R complex and blocks the activity of IL22 (in vitro). IL22RA2 may play an important role as an IL22 antagonist in the regulation of inflammatory responses. It has been described that human IL22RA2 gene encodes three alternatively spliced isoforms called CRF2-10L, CRF2-10, and CRF2-10s, with molecular weights of 31 kDa, 27 kDa, and 15 kDa, respectively.

Loading...
||
New chat Able
正在加载,请稍候...