Anti-Mouse IL-23 p19 Rabbit Recombinant Antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Mouse IL-23 p19 Rabbit Recombinant Antibody, PBS Only (98392-1-PBS)

• 

  FC experiment of Transfected HEK-293T using 98392-1-RR (same clone as 98392-1-PBS)

  1x10^6 HEK-293T cells(left) and IL23A -transfected HEK-293T cells(right) were stained with 0.25 ug Anti-Mouse IL23A Rabbit RecAb (98392-1-RR, Clone:242139G12) and APC-Conjugated Goat Anti-Rabbit IgG(H+L).Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98392-1-PBS in a different storage buffer formulation.

• 

  FC experiment of Transfected HEK-293T using 98392-1-RR (same clone as 98392-1-PBS)

  1x10^6 HEK-293T cells(left) and IL23A -transfected HEK-293T cells(right) were stained with 0.25 ug Anti-Mouse IL23A Rabbit RecAb (98392-1-RR, Clone:242139G12)(red), or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue) and APC-Conjugated Goat Anti-Rabbit IgG(H+L).Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98392-1-PBS in a different storage buffer formulation.

IL-23 p19 Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98392-1-PBS

Clone No.242139G12

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Synonyms

IL-23 subunit alpha, Il23a, IL-23A, IL-23-A, IL23P19

---

Product Information

98392-1-PBS targets IL-23 p19 in FC (Intra) applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1634

  Product name: Recombinant Mouse IL-23 p19/IL23A protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 22-196 aa of NM_031252.2

  Sequence: VPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA

• Full Name: interleukin 23, alpha subunit p19
• Calculated Molecular Weight: 22 kDa
• GenBank Accession Number: NM_031252.2
• Gene Symbol: Il23a
• Gene ID (NCBI): 83430
• RRID: AB_3746037
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9EQ14
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IL-12 and IL-23 are heterodimeric cytokines that share a common p40 subunit (PMID: 11114383). IL-12 is composed of the IL-12 p40 subunit linked to the IL-12 p35 subunit, and the heterodimer signals through the IL-12 receptor (IL-12R), which comprises the IL-12Rβ1 and IL-12Rβ2 subunits. IL-23 is composed of the IL-23 p19 subunit and the IL-12 p40 (IL-12/23p40) subunit, which signals through IL-23R and IL-12Rβ1 (PMID: 11114383; 26121196 ). IL-12/IL-23 p40 also exists as a monomer and as a homodimer which can act as a potent IL-12 antagonist (PMID: 8958912; 18783467). IL-12/IL-23 p40 is produced by antigen-presenting cells, such as dendritic cells (DCs), monocytes, macrophages, neutrophils and, to a lesser extent, B cells (PMID: 20476918).