Anti-Human IL-24 Rabbit Recombinant Antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Human IL-24 Rabbit Recombinant Antibody, PBS Only (98735-3-PBS)

IL-24 Uni-rAb^® Recombinant Antibody for IHC, FC (Intra)

Cat No. 98735-3-PBS

Clone No.251947A2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, FC (Intra)

Synonyms

IL24, IL 24, interleukin 24, Interleukin-24, Melanoma differentiation-associated gene 7 protein

• 

  IHC staining of human tonsillitis using 98735-3-RR (same clone as 98735-3-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 98735-3-RR (IL-24 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 98735-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 98735-3-RR (same clone as 98735-3-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 98735-3-RR (IL-24 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 98735-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of CHO using 98735-3-RR (same clone as 98735-3-PBS)

  1x10^6 CHO cells or IL-24 transfected CHO cells were intracellularly stained with 0.25 ug Anti-Human IL-24 Rabbit RecAb (98735-3-RR, Clone: 251947A2) and CoraLite647-conjugated F(ab')2 Fragment Donkey Anti-Rabbit IgG (H+L) (SA00014-7). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019). This data was developed using the same antibody clone with 98735-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 98735-3-RR

  Biolayer interferometry (BLI) kinetic assays of 98735-3-RR against Human IL-24 were performed. The affinity constant is below 1 pM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

98735-3-PBS targets IL-24 in IHC, FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4971

  Product name: Recombinant Human IL-24 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 52-206 aa of BC009681

  Sequence: QEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL

• Full Name: interleukin 24
• Calculated Molecular Weight: 207 aa, 24 kDa
• GenBank Accession Number: BC009681
• Gene Symbol: IL-24
• Gene ID (NCBI): 11009
• RRID: AB_3746304
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13007
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Interleukin-24 (IL-24), also known as Melanoma Differentiation-Associated gene 7 (mda-7), is a protein that belongs to the IL-10 family of cytokines. It was initially discovered in 1995 by researchers Paul B. Fisher and colleagues as a gene that is induced during the terminal differentiation of melanoma cells. IL-24 is secreted by multiple cell types, such as immune cells (T cells, B cells, NK cells, macrophages), and non-immune cells (epithelial cells and fibroblasts).