Mouse IL-25/IL-17E Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86396-1-RR (same clone as 86396-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86396-1-RR (IL-25/IL-17E antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86396-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat testis using 86396-1-RR (same clone as 86396-1-PBS)

  rat testis tissue were subjected to SDS PAGE followed by western blot with 86396-1-RR (IL-25/IL-17E antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86396-1-PBS in a different storage buffer formulation.

IL-25/IL-17E Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86396-1-PBS

Clone No.250033G5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Il17e, Interleukin-17E, Interleukin-25

---

Product Information

86396-1-PBS targets IL-25/IL-17E in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3316

  Product name: recombinant mouse IL25/IL-17E protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 17-169 aa of NM_080729.3

  Sequence: VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA

• Full Name: interleukin 25
• Calculated Molecular Weight: 19KD
• Observed Molecular Weight: 20 kda
• GenBank Accession Number: NM_080729.3
• Gene Symbol: Il25
• Gene ID (NCBI): 140806
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8VHH8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.