Anti-Mouse IL-25/IL-17E Rabbit Recombinant Antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Mouse IL-25/IL-17E Rabbit Recombinant Antibody, PBS Only (98536-3-PBS)

IL-25/IL-17E Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98536-3-PBS Copied!

Clone No. 250033D3

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Synonyms

Il17e, IL-17E, Il25, IL-25, Interleukin-17E

• 

  FC experiment of Transfected HEK-293T using 98536-3-RR (same clone as 98536-3-PBS)

  1x10^6 HEK-293T cells or IL-25/IL-17E transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Mouse IL-25/IL-17E Rabbit RecAb (98536-3-RR, Clone: 250033D3) and Multi-rAb CoraLite ® Plus 647-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR005). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98536-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of Transfected HEK-293T using 98536-3-RR (same clone as 98536-3-PBS)

  1x10^6 HEK-293T cells or IL-25/IL-17E transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Mouse IL-25/IL-17E Rabbit RecAb (98536-3-RR, Clone: 250033D3) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and Multi-rAb CoraLite ® Plus 647-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR005). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98536-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for IL-25/IL-17E in ?

Chat with Able

---

Product Information

98536-3-PBS targets IL-25/IL-17E in FC (Intra) applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3316

  Product name: Recombinant Mouse IL-25/IL-17E protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 17-169 aa of NM_080729.3

  Sequence: VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA

• Full Name: interleukin 25
• Calculated Molecular Weight: 19KD
• GenBank Accession Number: NM_080729.3
• Gene Symbol: Il25
• Gene ID (NCBI): 140806
• RRID: AB_3746163
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8VHH8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.