IL-28A Polyclonal antibody, PBS Only

IL-28A Polyclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 22646-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

22646-1-PBS targets IL-28A in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18525

Product name: Recombinant human IL-28A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 21-91 aa of BC113583

Sequence: TVTGAVPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQV

Predict reactive species
Full Name interleukin 28A (interferon, lambda 2)
Calculated Molecular Weight 200 aa, 22 kDa
GenBank Accession NumberBC113583
Gene Symbol IL-28A
Gene ID (NCBI) 282616
RRIDAB_2879141
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8IZJ0
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

IL28A, also named as IFNL2 and ZCYT020, is a cytokine with immunomodulatory activity. It up-regulates MHC class I antigen expression. IL28A is a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1. The ligand/receptor complex seems to signal through the Jak-STAT pathway. It plays a significant role in the antiviral immune defense in the intestinal epithelium.

Loading...
||
New chat Able
正在加载,请稍候...