Filter: AllSandwich ELISASample testIHCIF-P

Sandwich ELISA standard curve of MP50008-1
Sandwich ELISA standard curve of MP50008-1, IL-28A Monoclonal Matched Antibody Pair - PBS only. 60270-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard HZ-1235. 68669-1-PBS was HRP conjugated as the detection antibody. Range: 15.6-1000 pg/mL.
Sample test of MP50008-1
A549 cells were cultured unstimulated or stimulated with 10 μg/mL Poly I:C and 5 μg/mL Lip for 1 day. The mean IL-28A concentration was undetectable in unstimulated supernatant, 3,774.2 pg/mL in stimulated supernatant.
Sample test of MP50008-1
HUVEC cells were cultured unstimulated or stimulated with 100 ng/mL IFN-a and 10 μg/mL Poly I:C for 3 hours. The mean IL-28A concentration was undetectable in unstimulated supernatant, 70.0 pg/mL in stimulated supernatant.
IHC staining of human tonsillitis using 60270-1-Ig (same clone as 60270-1-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 60270-1-Ig (IL-28A antibody at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 60270-1-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 60270-1-Ig (same clone as 60270-1-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 60270-1-Ig (IL-28A antibody at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 60270-1-PBS in a different storage buffer formulation.
IHC staining of human small intestine using 60270-1-Ig (same clone as 60270-1-PBS)
Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 60270-1-Ig (IL-28A antibody at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 60270-1-PBS in a different storage buffer formulation.
IHC staining of human small intestine using 60270-1-Ig (same clone as 60270-1-PBS)
Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 60270-1-Ig (IL-28A antibody at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 60270-1-PBS in a different storage buffer formulation.
IF Staining of human tonsillitis using 60270-1-Ig (same clone as 60270-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using IL-28A antibody (60270-1-Ig, Clone: 3B4A1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 60270-1-PBS in a different storage buffer formulation.
IF Staining of human tonsillitis using 60270-1-Ig (same clone as 60270-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using IL-28A antibody (60270-1-Ig, Clone: 3B4A1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 60270-1-PBS in a different storage buffer formulation.

IL-28A Monoclonal antibody, PBS Only (Capture)

IL-28A Monoclonal Antibody for IHC, IF-P, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 60270-1-PBS

Clone No.3B4A1

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IHC, IF-P, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

IL28A, Cytokine Zcyto20, IFN lambda 2, IFNL2, IFN-lambda-2

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

60270-1-PBS targets IL-28A as part of a matched antibody pair:

MP50008-1: 60270-1-PBS capture and 68669-1-PBS detection (validated in Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity	human
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Affinity	K_D=1.77 x 10⁹M K_Off=4.10 x 10^-5M K_On=2.31 x 10⁴M
Immunogen	CatNo: Ag18525 Product name: Recombinant human IL-28A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 21-91 aa of BC113583 Sequence: TVTGAVPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQV Predict reactive species
Full Name	interleukin 28A (interferon, lambda 2)
Calculated Molecular Weight	200 aa, 22 kDa
GenBank Accession Number	BC113583
Gene Symbol	IL-28A
Gene ID (NCBI)	282616
RRID	AB_2881390
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	Q8IZJ0
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

IL28A, also named as IFNL2 and ZCYT020, is a cytokine with immunomodulatory activity. It up-regulates MHC class I antigen expression. IL28A is a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1. The ligand/receptor complex seems to signal through the Jak-STAT pathway. It plays a significant role in the antiviral immune defense in the intestinal epithelium.