Able AI
What's the best dilution for IL-3 in ?
Product Information
83544-2-PBS targets IL-3 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg0829 Product name: Recombinant Human IL-3 protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 20-152 aa of NM_000588.3 Sequence: APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF Predict reactive species |
| Full Name | interleukin 3 (colony-stimulating factor, multiple) |
| Calculated Molecular Weight | 17 kDa |
| GenBank Accession Number | NM_000588.3 |
| Gene Symbol | IL-3 |
| Gene ID (NCBI) | 3562 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P08700 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
