IL-32 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• IL-32 Recombinant monoclonal antibody (86678-1-RR)

• 

  WB analysis of NK-92 using 86678-1-RR

  NK-92 cells were subjected to SDS PAGE followed by western blot with 86678-1-RR (IL-32 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

IL-32 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86678-1-RR

Clone No.250373F3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

IL32, IL 32, interleukin 32, interleukin32, Interleukin-32

---

Tested Applications

• Positive WB detected in: NK-92 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86678-1-RR targets IL-32 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3224

  Product name: Recombinant Human IL-32 protein (isoform alpha, rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 1-131 aa of NM_001012633.1

  Sequence: MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKSYGAPRGDKEELTPQKCSEPQSSK

• Full Name: interleukin 32
• Calculated Molecular Weight: 15 kDa
• Observed Molecular Weight: 22-25 kDa
• GenBank Accession Number: NM_001012633.1
• Gene Symbol: IL-32
• Gene ID (NCBI): 9235
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P24001-4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin 32 (IL32) is a member of the cytokine family. IL32 contains a tyrosine sulfation site, 3 potential N-myristoylation sites, multiple putative phosphorylation sites, and an RGD cell-attachment sequence. IL32 is a predominantly intracellular proinflammatory cytokine produced by epithelial cells, monocytes, T-lymphocytes and natural killer cells, and is involved in inflammation and cancer development. IL32 is able to induce the release a variety of pro-inflammatory cytokines such as IL8, tumor necrosis factor-α (TNFα) and IL6. Expression of this protein is increased after the activation of T-cells by mitogens or the activation of NK cells by IL-2.