IL-33 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA sample test of MP00763-4

  The mean IL-33 concentration was determined to be 4.6 ng/mL in human placenta tissue extract based on a 3.8 mg/mL extract load.

• 

  Sandwich ELISA sample test of MP00763-4

  THP-1 cells were cultured unstimulated or stimulated with 1 μg/mL LPS and 50 ng/mL PMA for 1 day. The mean IL-33 concentration was determined to be 5.2 pg/mL in unstimulated supernatant and 111.7 pg/mL in stimulated supernatant.

• 

  Sandwich ELISA sample test of MP00763-4

  Plasma of eight individual healthy human donors was measured. The IL-33 concentration of detected samples was determined to be 19.5 pg/mL with a range of ND-65.6 pg/mL.

• 

  Sandwich ELISA standard curve of MP00763-4

  Sandwich ELISA standard curve of MP00763-4, Human IL-33 Recombinant Matched Antibody Pair - PBS only. 83765-6-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg7061. 83765-5-PBS was HRP conjugated as the detection antibody. Range: 23.4-1500 pg/mL.

IL-33 Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA

Cat No. 83765-6-PBS

Clone No.252156C5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA

Synonyms

IL33, 109-270, 95-270, 99-270, C9orf26

---

Product Information

83765-6-PBS targets IL-33 as part of a matched antibody pair:

MP00763-4: 83765-6-PBS capture and 83765-5-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg7061

  Product name: Recombinant human IL33 protein

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 122-270 aa of BC047085

  Sequence: YLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET

• Full Name: interleukin 33
• Calculated Molecular Weight: 30 kDa
• GenBank Accession Number: BC047085
• Gene Symbol: IL-33
• Gene ID (NCBI): 90865
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95760
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.