Home
Products
Primary Antibodies
Flow Cytometry Antibodies
Anti-Human IL-33 Rabbit Recombinant Antibody (98364-2-RR)

Anti-Human IL-33 Rabbit Recombinant Antibody

IL-33 Uni-rAb^® Recombinant Antibody for IHC, FC (Intra)

Cat No. 98364-2-RR

Clone No. 252156B10

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, FC (Intra)

Synonyms

IL33, C9orf26, IL 1F11, IL 33, IL-1F11

Formulation: PBS, Azide

PBS, Azide

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllIHCFC (Intra)

IHC staining of human colon using 98364-2-RR
Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 98364-2-RR (IL-33 antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon using 98364-2-RR
Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 98364-2-RR (IL-33 antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
FC experiment of human PBMCs using 98364-2-RR
1x10^6 human PBMCs were intracellularly stained with 0.25 ug Anti-Human IL-33 Rabbit RecAb (98364-2-RR, Clone:252156B10), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) and PE-conjugated Goat Anti-Rabbit IgG. Cells were then stained with CoraLite® Plus 647 Anti-Human CD19. Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 human PBMCs were intracellularly stained with 0.25 ug Anti-Human IL-33 Rabbit RecAb (98364-2-RR, Clone:252156B10), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) and PE-conjugated Goat Anti-Rabbit IgG. Cells were then stained with CoraLite® Plus 647 Anti-Human CD19. Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).
FC experiment of human PBMCs using 98364-2-RR
1x10^6 human PBMCs were intracellularly stained with 0.25 ug Anti-Human IL-33 Rabbit RecAb (98364-2-RR, Clone:252156B10) (red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue) and PE-conjugated Goat Anti-Rabbit IgG. Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for IL-33 in ?

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive IHC detected in	human colon tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive FC (Intra) detected in	human PBMCs

Recommended dilution

Application	Dilution
Immunohistochemistry (IHC)	IHC : 1:2500-1:10000
Flow Cytometry (FC) (INTRA)	FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

98364-2-RR targets IL-33 in IHC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg7061 Product name: Recombinant human IL33 protein Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 122-270 aa of BC047085 Sequence: YLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET Predict reactive species
Full Name	interleukin 33
Calculated Molecular Weight	30 kDa
GenBank Accession Number	BC047085
Gene Symbol	IL-33
Gene ID (NCBI)	90865
RRID	AB_3746014
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	O95760
Storage Buffer	PBS with 0.09% sodium azide, pH 7.3.
Storage Conditions	Store at 2 - 8°C. Stable for one year after shipment.

Background Information

IL-33 is an IL-1 family cytokine and nuclear alarmin, is constitutively expressed in epithelial barrier tissues and human blood vessels. IL-33 is involved in the maturation of Th2 cells and the activation of mast cells, basophils, eosinophils and natural killer cells. It also acts as a chemoattractant for Th2 cells, and may function as an "alarmin", that amplifies immune responses during tissue injury.