Anti-Mouse IL-4 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of C57BL/6 Th2-polarized splenocytes using 98360-2-RR (same clone as 98360-2-PBS)

  1x10^6 unstimulated or PMA, Ionomycin and Brefeldin A treated C57BL/6 Th2-polarized splenocytes were intracellularly stained with 0.125 ug Anti-Mouse IL-4 Rabbit RecAb (98360-2-RR, Clone: 242736G8) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were co-stained with APC Anti-Mouse CD4 (GK1.5) (APC-65104, Clone: GK1.5). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98360-2-PBS in a different storage buffer formulation.

IL-4 antibodies are versatile tools for investigating IL-4’s roles in immunity, allergy, autoimmunity, and cancer, supporting a wide range of molecular, cellular, and functional assays. Proteintech has an extensive validated IL-4 antibodies for FC (Intra).

Cat No. 98360-2-PBS

Clone No.242736G8

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Synonyms

242736G8, Il 4, Il4, interleukin 4

---

Product Information

98360-2-PBS targets IL-4 in FC (Intra) applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3750

  Product name: Recombinant Mouse IL-4 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 21-140 aa of BC027514

  Sequence: HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

• Full Name: interleukin 4
• GenBank Accession Number: BC027514
• Gene Symbol: IL-4
• Gene ID (NCBI): 16189
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P07750
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Interleukin-4 (IL-4), a member of the α-helical cytokine family, is produced by activated CD4+ T cells, basophils, and mast cells. It promotes the proliferation and differentiation of antigen-presenting cells. IL-4 also plays a pivotal role in antibody isotype switching and stimulates the production of IgE. This cytokine has been applied in the treatment of autoimmune disorders like multiple myeloma, cancer, psoriasis, and arthritis. IL-4 has also been extensively applied to inhibit detrimental effect of Th1. It may promote the growth of epithelial tumors by mediating increased proliferation and survival. (PMID: 24489573;3049907;21663408)