IL-4RA/CD124 Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 84414-4-PBS

  Biolayer interferometry (BLl) kinetic assays of 84414-4-PBS against Human IL-4RA/CD124 were performed. The affinity constant is below 1 pM.

IL-4RA/CD124 Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 84414-4-PBS

Clone No.241824E5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

IL4R, CD124, IL 4 binding protein, IL 4 receptor subunit alpha, IL 4R alpha

---

Product Information

84414-4-PBS targets IL-4RA/CD124 in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1684

  Product name: Recombinant Human IL-4 R alpha/CD124 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 26-232 aa of NM_000418.4

  Sequence: MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH

• Full Name: interleukin 4 receptor
• Calculated Molecular Weight: 90 kDa
• GenBank Accession Number: NM_000418.4
• Gene Symbol: IL-4R
• Gene ID (NCBI): 3566
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P24394-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.