Mouse IL-4RA/CD124 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of NIH/3T3 using 84758-5-RR (same clone as 84758-5-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 84758-5-RR (IL-4 R alpha/CD124 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84758-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 84758-5-RR (same clone as 84758-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 84758-5-RR (IL-4RA/CD124 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84758-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 84758-5-RR (same clone as 84758-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 84758-5-RR (IL-4RA/CD124 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84758-5-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsil using 84758-5-RR (same clone as 84758-5-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsil tissue slide using 84758-5-RR (IL-4RA/CD124 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84758-5-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsil using 84758-5-RR (same clone as 84758-5-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsil tissue slide using 84758-5-RR (IL-4RA/CD124 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84758-5-PBS in a different storage buffer formulation.

• 

  IHC staining of rat spleen using 84758-5-RR (same clone as 84758-5-PBS)

  Immunohistochemical analysis of paraffin-embedded rat spleen tissue slide using 84758-5-RR (IL-4RA/CD124 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84758-5-PBS in a different storage buffer formulation.

• 

  IHC staining of rat spleen using 84758-5-RR (same clone as 84758-5-PBS)

  Immunohistochemical analysis of paraffin-embedded rat spleen tissue slide using 84758-5-RR (IL-4RA/CD124 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84758-5-PBS in a different storage buffer formulation.

IL-4RA/CD124 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 84758-5-PBS

Clone No.242262E3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

242262E3, CD124, IL-4 receptor subunit alpha, Il4r, IL-4R subunit alpha

---

Product Information

84758-5-PBS targets IL-4RA/CD124 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2176

  Product name: Recombinant Mouse IL-4RA/CD124 protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 26-233 aa of NM_001008700.3

  Sequence: IKVLGEPTCFSDYIRTSTCEWFLDSAVDCSSQLCLHYRLMFFEFSENLTCIPRNSASTVCVCHMEMNRPVQSDRYQMELWAEHRQLWQGSFSPSGNVKPLAPDNLTLHTNVSDEWLLTWNNLYPSNNLLYKDLISMVNISREDNPAEFIVYNVTYKEPRLSFPINILMSGVYYTARVRVRSQILTGTWSEWSPSITWYNHFQLPLIQR

• Full Name: interleukin 4 receptor, alpha
• Calculated Molecular Weight: 88 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: NM_001008700.3
• Gene Symbol: Il4ra
• Gene ID (NCBI): 16190
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P16382-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IL-4 receptor alpha chain (IL-4RA), also known as CD124, is a transmembrane glycoprotein expressed on a wide variety of hematopoietic and non-hematopoietic cells. It is a receptor for both IL-4 and IL-13. IL-4RA can complex with the common gamma chain (IL-2R gamma or CD132) and utilizes JAK1 and JAK2 for signal transduction, while complexes of IL-4RA with IL-13RA1 subunit mediate signals via JAK2 and Tyk2. The IL-4 response is involved in promoting Th2 differentiation. The IL-4/IL-13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation.