Anti-Human IL-4RA/CD124 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of human PBMCs using 98203-1-RR (same clone as 98203-1-PBS)

  1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human IL-4RA/CD124 Rabbit Recombinant Antibody (98203-1-RR, Clone:241824D8) or Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were then stained with CoraLite® Plus 647 Anti-Human CD19. Cells were not fixed. Lymphocytes were gated. This data was developed using the same antibody clone with 98203-1-PBS in a different storage buffer formulation.

• 

  FC experiment of human PBMCs using 98203-1-RR (same clone as 98203-1-PBS)

  1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human IL-4RA/CD124 Rabbit Recombinant Antibody (98203-1-RR, Clone:241824D8) (red) or Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. Lymphocytes were gated. This data was developed using the same antibody clone with 98203-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 98203-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98203-1-RR against Human IL-4RA/CD124 were performed. The affinity constant is 53.6 pM.

IL-4RA/CD124 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98203-1-PBS

Clone No.241824D8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

IL4R, 241824D8, CD124, IL 4 binding protein, IL 4 receptor subunit alpha

---

Product Information

98203-1-PBS targets IL-4RA/CD124 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1684

  Product name: Recombinant Human IL-4 R alpha/CD124 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 26-232 aa of NM_000418.4

  Sequence: MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH

• Full Name: interleukin 4 receptor
• Calculated Molecular Weight: 90 kDa
• GenBank Accession Number: NM_000418.4
• Gene Symbol: IL-4R
• Gene ID (NCBI): 3566
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P24394-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IL-4 receptor alpha chain (IL-4RA), also known as CD124, is a transmembrane glycoprotein expressed on a wide variety of hematopoietic and non-hematopoietic cells. It is a receptor for both IL-4 and IL-13. IL-4RA can complex with the common gamma chain (IL-2R gamma or CD132) and utilizes JAK1 and JAK2 for signal transduction, while complexes of IL-4RA with IL-13RA1 subunit mediate signals via JAK2 and Tyk2. The IL-4 response is involved in promoting Th2 differentiation. The IL-4/IL-13 responses are involved in regulating IgE production and chemokine and mucus production at sites of allergic inflammation.