IL-7 Monoclonal antibody, PBS Only (Detector)

IL-7 Monoclonal Antibody for Cytometric bead array, Indirect ELISA
Cat No. 60206-1-PBS
Clone No.5D5G7

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

IL7, Interleukin-7, interleukin 7, IL 7, 5D5G7

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60206-1-PBS targets IL-7 as part of a matched antibody pair:

MP50135-1: 60206-2-PBS capture and 60206-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Affinity
KD=7.40 x 10-10M
KOff=7.82 x 10-6M
KOn=1.06 x 104M
Immunogen

CatNo: Ag16314

Product name: Recombinant human IL-7 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-177 aa of BC047698

Sequence: MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH

Predict reactive species
Full Name interleukin 7
Calculated Molecular Weight 20 kDa
GenBank Accession NumberBC047698
Gene Symbol IL-7
Gene ID (NCBI) 3574
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP13232
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

IL-7 is one of the members of IL-2 superfamily. IL-7 is a hematopoietic growth factor secreted by stromal cells in the bone marrow and thymus. It is also produced by keratinocytes, dendritic cells, hepatocytes, neurons, and epithelial cells, but is not produced by normal lymphocytes. IL7 plays an active role in the development, survival, maintaining and restoring homeostasis of mature T lymphocytes. It is also a key regulator of the commitment, survival, proliferation and maturation of B cells during development. Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) infection can be a potent inducer of proinflammatory cytokines and chemokines which may defend against the infection, but may also mediate destructive lung injury. Elevated serum IL7 levels, together with several other circulating cytokines and chemokines, has been found to be associated with the severity of Coronavirus Disease 19 (COVID-19).

Loading...
||
New chat Able
正在加载,请稍候...