IL-10RB Polyclonal antibody

• 

  WB analysis of rat skeletal muscle using 15102-1-AP

  rat skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15102-1-AP (IL10RB antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 15102-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 15102-1-AP (IL10RB antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 15102-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15102-1-AP (IL10RB antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

IL-10RB Polyclonal Antibody for WB, ELISA

Cat No. 15102-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

CDW210B, CRF2 4, CRFB4, D21S58, D21S66, IL 10 receptor subunit beta, IL 10R subunit 2, IL 10R subunit beta, IL 10R2, IL 10RB, IL10RB, IL-10RB, IL-10Rβ, interleukin 10 receptor, beta

---

Tested Applications

• Positive WB detected in: rat skeletal muscle tissue, Jurkat cells, mouse skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:300-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below

Product Information

15102-1-AP targets IL-10RB in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7445

  Product name: Recombinant human IL-10RB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 18-225 aa of BC001903

  Sequence: LGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSWMVAV

• Full Name: interleukin 10 receptor, beta
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 42-45 kDa
• GenBank Accession Number: BC001903
• Gene Symbol: IL10RB
• Gene ID (NCBI): 3588
• RRID: AB_10638926
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q08334
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin-10 (IL-10) is an anti-inflammatory cytokine that plays a critical role in maintaining immune system balance. IL-10 signals through a receptor complex consisting of two molecules of the IL-10R alpha-chain (IL-10RA) and two molecules of the accessory IL-10R beta-chain (IL-10RB) (PMID: 22236434). IL-10RA and IL-10RB are members of the type II cytokine receptor family. IL-10RB, also known as IL-10R2 or CDw210b, is the signaling subunit of the IL-10R complex and is constitutively expressed in a variety of cell types (PMID: 24507158). Binding of IL-10 to the IL-10R complex leads to JAK1- and TYK2-mediated phosphorylation of STAT3 (PMID: 11244051; 10433356). IL-10RB is also shared by several other cytokines, including IL22, IL-26, IFN-γ, IL-28A/B and IL29 (PMID: 22236434).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Adv Healthc Mater; Macrophage-Derived Nanosponges Adsorb Cytokines and Modulate Macrophage Polarization for Renal Cell Carcinoma Immunotherapy; Authors - Yao Jiang
human	WB	Biochim Biophys Acta Mol Basis Dis; IL-22 ameliorated cardiomyocyte apoptosis in cardiac ischemia/reperfusion injury by blocking mitochondrial membrane potential decrease, inhibiting ROS and cytochrome C.; Authors - Yang Che
mouse	WB	J Alzheimers Dis; Regulation of the Human IL-10RB Gene Expression by Sp8 and Sp9; Authors - Shuyue Luo
mouse	WB	PLoS One; Endogenous interleukin-22 prevents cardiac rupture after myocardial infarction in mice; Authors - Mai Yamamoto