IL11RA Recombinant monoclonal antibody, PBS Only (Detector)

IL11RA Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 83180-2-PBS
Clone No.240019F3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

IL 11 receptor subunit alpha, IL 11R alpha, IL 11R subunit alpha, IL 11RA, IL-11 receptor subunit alpha

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83180-2-PBS targets IL11RA as part of a matched antibody pair:

MP00268-1: 83180-4-PBS capture and 83180-2-PBS detection (validated in Cytometric bead array)

MP00268-2: 83180-3-PBS capture and 83180-2-PBS detection (validated in Cytometric bead array)

MP00268-3: 83180-1-PBS capture and 83180-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag28360

Product name: Recombinant human IL-11RA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 39-164 aa of BC003110

Sequence: QPGRSVKLCCPGVTAGDPVSWFRDGEPKLLQGPDSGLGHELVLAQADSTDEGTYICQTLDGALGGTVTLQLGYPPARPVVSCQAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGADSQRRSPS

Predict reactive species
Full Name interleukin 11 receptor, alpha
Calculated Molecular Weight 45 kDa
GenBank Accession NumberBC003110
Gene Symbol IL11RA
Gene ID (NCBI) 3590
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14626
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...