IL-12/IL-23 p40 Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 83008-3-PBS

  Biolayer interferometry (BLl) kinetic assay of 83008-3-PBS against Human IL-12/IL-23 p40 was performed. The affinity constant is below 1 pM.

IL-12/IL-23 p40 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 83008-3-PBS

Clone No.240008G6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

IL12B, CLMF p40, Cytotoxic lymphocyte maturation factor 40 kDa subunit, IL 12 P40, IL 12 subunit p40

---

Product Information

83008-3-PBS targets IL-12/IL-23 p40 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0431

  Product name: Recombinant Human IL-12/IL-23 p40 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 23-328 aa of BC067498

  Sequence: IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

• Full Name: interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40)
• Calculated Molecular Weight: 328 aa, 37 kDa
• GenBank Accession Number: BC067498
• Gene Symbol: IL12B
• Gene ID (NCBI): 3593
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P29460
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.