IL-12RB1/CD212 Polyclonal antibody

• 

  WB analysis of K-562 using 13287-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 13287-1-AP (IL12RB1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 13287-1-AP

  WB result of IL-12RB1 antibody (13287-1-AP; 1:400; incubated at room temperature for 1.5 hours) with sh-Control and sh-IL-12RB1 transfected Jurkat cells.

• 

  IP experiment of K-562 using 13287-1-AP

  IP result of anti-IL-12RB1 (IP:13287-1-AP, 4ug; Detection:13287-1-AP 1:300) with K-562 cells lysate 1820 ug.

• 

  IHC staining of human tonsillitis using 13287-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 13287-1-AP (IL12RB1 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

IL-12RB1/CD212 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 13287-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

IL12RB1, CD212, IL 12R beta 1, IL 12R subunit beta 1, IL 12RB1

---

Tested Applications

• Positive WB detected in: K-562 cells, Jurkat cells
• Positive IP detected in: K-562 cells
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below
• IF: See 2 publications below
• IP: See 1 publications below

Product Information

13287-1-AP targets IL-12RB1/CD212 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3983

  Product name: Recombinant human IL-12RB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-381 aa of BC029121

  Sequence: CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRRLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTDGMISAHCNLRLPDSRDSPASASRVAGITGICHHTRLILYF

• Full Name: interleukin 12 receptor, beta 1
• Calculated Molecular Weight: 662 aa, 73 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC029121
• Gene Symbol: IL12RB1
• Gene ID (NCBI): 3594
• RRID: AB_2124039
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P42701
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IL12RB1, also named as Interleukin-12 receptor subunit beta-1 or CD212, is a 662 amino acid protein, which contains 5 fibronectin type-III domains and belongs to the type I cytokine receptor family. Type 2 subfamily. IL12RB1 localizes in the membrane and functions as an interleukin receptor which binds interleukin-12 with low affinity and is involved in IL12 transduction. Associated with IL12RB2 it forms a functional, high affinity receptor for IL12. Associates also with IL23R to form the interleukin-23 receptor which functions in IL23 signal transduction probably through activation of the Jak-Stat signaling cascade.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
monkey,human	WB,IP,IF	J Immunol; Inflammatory signals direct expression of human IL12RB1 into multiple distinct isoforms.; Authors - Ford Nicole R NR
mouse	IHC,IF	Front Med (Lausanne); Serum IL-12p40: A novel biomarker for early prediction of minimal change disease relapse following glucocorticoids therapy; Authors - Mengqiu Bai