IL-15 Polyclonal antibody

IL-15 Polyclonal Antibody for ELISA
Cat No. 12962-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

IL15, Interleukin-15, IL 15

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

12962-1-AP targets IL-15 in ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3650

Product name: Recombinant human IL-15 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-162 aa of BC018149

Sequence: MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Predict reactive species
Full Name interleukin 15
Calculated Molecular Weight 18 kDa
GenBank Accession NumberBC018149
Gene Symbol IL15
Gene ID (NCBI) 3600
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP40933
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin 15 (IL15) is a cytokine important for the development, maturation, and function of many cells of the immune system including NK, NKT, gammadeltaT, and CD8(+) T cells. Its expression affects homeostasis and function of B cells through NK cell-derived IFNG. IL-15 binds a trimeric IL-15 receptor (IL-15R) complex formed by a specific receptor chain (IL-15Rα) combined with theβandγchains of the IL-2R, acting as signal transducing components. High levels of IL15 expression have been associated with the pathogenesis of autoimmune and inflammatory diseases like Crohn's disease, psoriasis, leukemias, rheumatoid arthritis (RA) and graft rejection, resulting in the IL15 system being a target of interest for the treatment of these diseases.

Loading...
||
New chat Able
正在加载,请稍候...