IL-18BP Polyclonal antibody

• Home
• Products
• Primary Antibodies
• IL-18BP Polyclonal antibody (14153-1-AP)

• Featured Product
• KD/KO Validated

IL-18BP Polyclonal Antibody for WB, ELISA

Cat No. 14153-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, ELISA

Synonyms

IL18BP, IL 18BP, IL18BPa, interleukin 18 binding protein, Interleukin-18-binding protein

• 

  WB analysis using 14153-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14153-1-AP (IL-18BP antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 14153-1-AP

  WB result of IL-18BP antibody (14153-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-IL-18BP transfected A549 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for IL-18BP in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14153-1-AP targets IL-18BP in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5335

  Product name: Recombinant human IL-18BP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 30-194 aa of BC044215

  Sequence: ATPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG

• Full Name: interleukin 18 binding protein
• Calculated Molecular Weight: 194 aa, 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC044215
• Gene Symbol: IL-18BP
• Gene ID (NCBI): 10068
• RRID: AB_2918034
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95998
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IL18BP, also named as adekinig-alfa, has 3 isoforms (Isoform A 21kd; B 12kd and D 17kd). Isoform A binds to IL-18 and inhibits its activity. IL18BP functions as an inhibitor of the early TH1 cytokine response. Highly glycosylated of IL18BP will migrate to be 40kd. A 58kd protein is IL18BP crosslinked IL18.

Publications

What published studies show

The IL-18BP Polyclonal antibody (Cat# 14153-1-AP) has 2 total citations. These appear in Bioactive Materials and Frontiers in Microbiology. The associated research fields include IBD-associated bone loss and bone microenvironment engineering, as well as ulcerative colitis and mucosal microbiology. Both citations used the antibody for Western blot in mouse samples.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Bioact Mater; Bone targeted microenvironment actuated engineered exosomes for precision therapy of IBD associated bone loss.; Authors - Jiang Liu
mouse	WB	Front Microbiol; Proteus mirabilis exacerbates ulcerative colitis by inhibiting mucin production; Authors - Zhihui Jiang