IL-36RN Monoclonal antibody

• 

  WB analysis of Recombinant protein using 60298-1-Ig

  Recombinant protein were subjected to SDS PAGE followed by western blot with 60298-1-Ig (IL36RN antibody at dilution of 1:2000 incubated at room temperature for 1.5 hours.

IL-36RN Monoclonal Antibody for WB, ELISA

Cat No. 60298-1-Ig

Clone No.5F11G6

Publications(1)

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IF, ELISA

Synonyms

FIL1, FIL1 delta, FIL1(DELTA), FIL1D, IL 1 delta, IL 1 related protein 3, IL 1F5, IL 1HY1, IL 1L1, IL 1ra homolog 1, IL 1RP3, IL1F5, IL1HY1, IL1L1, IL1RP3, IL-36RN, Interleukin 1 delta, Interleukin 1 family member 5, Interleukin 1 HY1, Interleukin 1 like protein 1

---

Tested Applications

• Positive WB detected in: Recombinant protein

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

60298-1-Ig targets IL-36RN in WB, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3780

  Product name: Recombinant human IL-1F5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-155 aa of BC024747

  Sequence: MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD

• Full Name: interleukin 1 family, member 5 (delta)
• Calculated Molecular Weight: 155 aa, 17 kDa
• GenBank Accession Number: BC024747
• Gene Symbol: IL-36RN
• Gene ID (NCBI): 26525
• RRID: AB_2881413
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UBH0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IL36RN is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). It inhibits the activity of interleukin-36 (IL36A,IL36B and IL36G) by binding to receptor IL1RL2 and preventing its association with the coreceptor IL1RAP for signaling.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Cancer Med; Enhanced IL36RN Expression and Its Association With Immune Microenvironment Predicts Poor Prognosis in Gastric Cancer; Authors - Xiaojing Zhang