IL-36 Beta/IL-1F8 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• IL-36 Beta/IL-1F8 Polyclonal antibody (18043-1-AP)

IL-36 Beta/IL-1F8 Polyclonal Antibody for IHC, ELISA

Cat No. 18043-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

FIL1, FIL1 (ETA), FIL1 eta, FIL1H, IL 1 eta, IL 1F8, IL 1H2, IL1 ETA, IL1F8, IL-1F8, IL1H2, IL36B, IL-36B, IL36-Beta, Interleukin 1 eta, Interleukin 1 family member 8, Interleukin 1 homolog 2, Interleukin-36 beta

• 

  IHC staining of human lung using 18043-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 18043-1-AP (IL36B antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 18043-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 18043-1-AP (IL36B antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for IL-36 Beta/IL-1F8 in ?

Chat with Able

---

Tested Applications

• Positive IHC detected in: human lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18043-1-AP targets IL-36 Beta/IL-1F8 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12675

  Product name: Recombinant human IL-1F8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-157 aa of BC101833

  Sequence: MNPQREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE

• Full Name: interleukin 1 family, member 8 (eta)
• Calculated Molecular Weight: 157 aa, 18 kDa
• GenBank Accession Number: BC101833
• Gene Symbol: IL-36 Beta/IL-1F8
• Gene ID (NCBI): 27177
• RRID: AB_2878487
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NZH7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The IL-36 Beta/IL-1F8 Polyclonal antibody (catalog number 18043-1-AP) has a total of 1 citation. It appears in the journal Experimental Dermatology (Exp Dermatol), published in 2025. The associated research field is dermatology, specifically examining clinical responses and transcriptomic analysis of spesolimab in a patient with severe dermatitis, multiple allergies, and metabolic wasting syndrome. The antibody was applied in immunohistochemistry (IHC) on human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Exp Dermatol; Clinical Responses and Transcriptomic Analysis of Spesolimab in a Girl With Severe Dermatitis, Multiple Allergies and Metabolic Wasting Syndrome; Authors - Jinxiang Yang