IL-20 Polyclonal antibody

• 

  WB analysis of HEK-293 using 18104-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 18104-1-AP (IL20 Antibody) at dilution of 1:700 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human tonsillitis using 18104-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 18104-1-AP (IL20 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 18104-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 18104-1-AP (IL20 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

IL-20 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 18104-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IF, IHC, ELISA

Synonyms

Cytokine Zcyto10, IL 20, IL20, interleukin 20, ZCYTO10

---

Tested Applications

• Positive WB detected in: HEK-293 cells
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

18104-1-AP targets IL-20 in WB, IF, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12447

  Product name: Recombinant human IL-20 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 26-176 aa of BC074949

  Sequence: KTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE

• Full Name: interleukin 20
• Calculated Molecular Weight: 406 aa, 44 kDa
• GenBank Accession Number: BC074949
• Gene Symbol: IL-20
• Gene ID (NCBI): 50604
• RRID: AB_2878501
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NYY1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin-20 (IL-20) is a protein belonging to the IL-10 family of cytokines. IL-20 receptor (IL-20R) and IL-20 are expressed in several normal tissue types, including the lung, skin, and kidney. IL-20 is a cytokine structurally related to interleukin 10. IL-20 is produced by activated keratinocytes and monocytes and transmits an intracellular signal through two distinct cell-surface receptor complexes on keratinocytes and other epithelial cells. IL-20 can stimulate STAT3 activation in keratinocytes. IL-20 regulates proliferation and differentiation of keratinocytes during inflammation, particularly inflammation associated with the skin. In addition, IL-20 also causes cell expansion of multipotential hematopoietic progenitor cells. IL-20 is highly associated with potent inflammatory diseases such as psoriasis, contact hypersensitivity, rheumatoid arthritis, and atherosclerosis.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Immunology; IL-20 is involved in obesity by modulation of adipogenesis and macrophage dysregulation.; Authors - Yu-Hsiang Hsu