IL-28B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• IL-28B Polyclonal antibody (24199-1-AP)

IL-28B Polyclonal Antibody for IF/ICC, ELISA

Cat No. 24199-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

IL28B, IL-28B/ IFNL3, IFN-lambda-3, IFNL4, IFNL3

• 

  IF Staining of HeLa using 24199-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using 24199-1-AP (IL28B/ IFNL3 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for IL-28B in ?

Chat with Able

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24199-1-AP targets IL-28B in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21491

  Product name: Recombinant human IL-28B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-196 aa of BC130316

  Sequence: MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

• Full Name: interleukin 28B (interferon, lambda 3)
• Calculated Molecular Weight: 196 aa, 22 kDa
• GenBank Accession Number: BC130316
• Gene Symbol: IL-28B
• Gene ID (NCBI): 282617
• RRID: AB_2879452
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IZI9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The IL-28B Polyclonal antibody (Cat# 24199-1-AP) has 1 total citation. The cited publication appeared in BMC Molecular and Cellular Biology (IF: 3), published in February 2020. The study investigated a minicircle DNA vector expressing interferon-lambda-3 for inhibiting hepatitis B virus replication in hepatocyte-derived cells, placing the research field within virology and liver biology. The antibody was used for Western blot analysis on human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	BMC Mol Cell Biol; Minicircle DNA vector expressing interferon-lambda-3 inhibits hepatitis B virus replication and expression in hepatocyte-derived cell line.; Authors - Xiaoyan Guo