IL29 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP02493-1

  Sandwich ELISA standard curve of MP02493-1, Human IL-29 Recombinant Matched Antibody Pair - PBS only. 86548-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg2843. 86548-1-PBS was HRP conjugated as the detection antibody. Range: 78.1-5000 pg/mL

• 

  Sample test of MP02493-1

  HUVEC human umbilical vein endothelial cells (1 x 10^6 cells/mL) were seeded in Endothelial Cell Medium (ECM) supplemented, and stimulated with 10 ng/mL IFN-α, 30 µg/mL Poly I:C and 5 µg/mL Lip for 3 hours. The mean IL-29 concentration was determined to be 69.1 pg/mL in unstimulated HUVEC supernatant, 5,268.2 pg/mL in stimulated HUVEC supernatant.

IL29 Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 86548-1-PBS

Clone No.250226A1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

Cytokine Zcyto21, IFN lambda 1, IFNL1, IFN-lambda-1, IL 29

---

Product Information

86548-1-PBS targets IL29 as part of a matched antibody pair:

MP02493-1: 86548-2-PBS capture and 86548-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2843

  Product name: recombinant human IL29 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 20-200 aa of NM_172140.1

  Sequence: GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST

• Full Name: interleukin 29 (interferon, lambda 1)
• Calculated Molecular Weight: 22 kDa
• GenBank Accession Number: NM_172140.1
• Gene Symbol: IL-29
• Gene ID (NCBI): 282618
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IU54
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.