IL2RB Polyclonal antibody

• Home
• Products
• Primary Antibodies
• IL2RB Polyclonal antibody (34322-1-AP)

IL2RB Polyclonal Antibody for WB, ELISA

Cat No. 34322-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, ELISA

Synonyms

CD122, High affinity IL-2 receptor subunit beta, IL-2 receptor subunit beta, IL-2R subunit beta, IL-2RB

• 

  WB analysis using 34322-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 34322-1-AP (IL2RB antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse spleen tissue, mouse thymus tissue, rat thymus tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

34322-1-AP targets IL2RB in WB, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg5274

  Product name: Recombinant Rat IL2RB protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 27-239 aa of NM_013195

  Sequence: AVNDCSHLKCFYNSRANVSCMWSPEEALNVTSCHIHAKSDMRHWNKTCELTPVRQASWACNLILGPLPDSQSLTSVDLLSLSVVCWEEKGWRRVKTCTFHPFDNLRLIAPHSLQVLHIETRRCNISWEVSQVSHYVNPYLEFEARRRLLDRSWEDASVFSLKQRQQWIFLETLTPDTSYELQVRVIAQRGKTRTWSPWSQPMAFRTRPADPKE

• Full Name: interleukin 2 receptor, beta
• Calculated Molecular Weight: 61 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: NM_013195
• Gene Symbol: Il2rb
• Gene ID (NCBI): 25746
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P26896
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The interleukin 2 receptor, which is involved in T cell-mediated immune responses, is present in 3 forms with respect to the ability to bind interleukin 2. The low-affinity form is a monomer of the alpha subunit and is not involved in signal transduction. The intermediate affinity form consists of an alpha/beta subunit heterodimer, while the high affinity form consists of an alpha/beta/gamma subunit heterotrimer. The beta subunit (IL2RB, also known as CD122 and p75) is involved in receptor-mediated endocytosis and transduces the mitogenic signals of interleukin 2.