Tested Applications
| Positive IHC detected in | human lung cancer tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11079-1-AP targets IL-32 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1484 Product name: Recombinant human IL-32 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-234 aa of BC009401 Sequence: MCFPKVLSDDMKKLKARMVMLLPTSAQGLGAWVSACDTEDTVGHLGPWRDKDPALWCQLCLSSQHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK Predict reactive species |
| Full Name | interleukin 32 |
| Calculated Molecular Weight | 27 kDa |
| GenBank Accession Number | BC009401 |
| Gene Symbol | IL-32 |
| Gene ID (NCBI) | 9235 |
| RRID | AB_2877745 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P24001 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Interleukin 32 (IL32) is a member of the cytokine family. IL32 contains a tyrosine sulfation site, 3 potential N-myristoylation sites, multiple putative phosphorylation sites, and an RGD cell-attachment sequence. IL32 is a predominantly intracellular proinflammatory cytokine produced by epithelial cells, monocytes, T-lymphocytes and natural killer cells, and is involved in inflammation and cancer development. IL32 is able to induce the release a variety of pro-inflammatory cytokines such as IL8, tumor necrosis factor-α (TNFα) and IL6. Expression of this protein is increased after the activation of T-cells by mitogens or the activation of NK cells by IL-2.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for IL-32 antibody 11079-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The IL-32 Polyclonal antibody (catalog number 11079-1-AP) has 17 total citations. These appear in journals including Frontiers in Immunology, Inflammation Research, International Immunopharmacology, Frontiers in Pharmacology, Journal of Cellular and Molecular Medicine, Journal of Hepatocellular Carcinoma, Biology of Reproduction, Journal of Neuroimmunology, Biomedical Research International, World Journal of Gastrointestinal Oncology, Experimental and Therapeutic Medicine, Translational Cancer Research, Respiratory Investigation, Oncology Letters, Translational Oncology, and Cellular and Molecular Gastroenterology and Hepatology. Research fields span oncology (various cancers), immunology, inflammation, cardiovascular disease, and reproductive biology.
| Species | Application | Title |
|---|---|---|
Front Immunol Subtype-specific NK cell-TAM interactions drive a novel prognostic signature in HNSCC. | ||
Inflamm Res Spatial transcriptomics identifies IL-32 as a lipid droplet-associated cytokine linked to tubular injury in human diabetic kidney disease. | ||
Int Immunopharmacol Shared chemoresistance genes in ESCC and cervical Cancer: Insights from pharmacogenomics and Mendelian randomization | ||
Front Pharmacol Targeting TIGIT Inhibits Bladder Cancer Metastasis Through Suppressing IL-32. | ||
J Cell Mol Med MicroRNA-29b-3p suppresses oral squamous cell carcinoma cell migration and invasion via IL32/AKT signalling pathway. | ||
J Hepatocell Carcinoma Identification and Validation of Novel Biomarkers for Hepatocellular Carcinoma, Liver Fibrosis/Cirrhosis and Chronic Hepatitis B via Transcriptome Sequencing Technology. |
Reviews
What customers say
Both reviewers gave this IL-32 polyclonal antibody a perfect 5-star rating. One user reported strong and reliable performance for IHC on FFPE tissue using a 1:200 dilution with overnight incubation at 4°C, and also noted success with immunofluorescence. The second reviewer confirmed its utility for both Western Blot and Immunohistochemistry applications. Overall, customers find this antibody dependable across multiple techniques, particularly for detecting IL-32 in tissue sections and lysates.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Aysa (Verified Customer) (10-31-2025) | Reliable and strong for IHC on FFPE tissue. O/N incubation at 4 degrees.
 |
Shriya (Verified Customer) (10-13-2025) | IL-32 Polyclonal antibody
|
