Use Able AI chat for product recommendations

IL3RA/CD123 Recombinant monoclonal antibody, PBS Only (Capture)

IL3RA/CD123 Uni-rAb® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 83243-3-PBS
Clone No.240042E5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Sandwich ELISA, Indirect ELISA, Sample test

IL3RA, 240042E5, CD123, hIL 3Ra, IL 3 receptor subunit alpha

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83243-3-PBS targets IL3RA/CD123 as part of a matched antibody pair:

MP00176-4: 83243-3-PBS capture and 83243-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4452

Product name: Recombinant human IL-3RA protein

Source: e coli.-derived, T-HIS

Tag: 6*His

Domain: 22-305 aa of BC035407

Sequence: DPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWR

Predict reactive species
Full Name interleukin 3 receptor, alpha (low affinity)
Calculated Molecular Weight 378 aa, 43 kDa
Observed Molecular Weight70 kDa
GenBank Accession NumberBC035407
Gene Symbol CD123
Gene ID (NCBI) 3563
ENSEMBL Gene IDENSG00000185291
RRIDAB_3670919
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP26951
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Interleukin-3 receptor subunit alpha (IL3RA), also known as CD123, belongs to the cytokine receptor family. It is a glycoprotein containing an extracellular domain, involving a predicted Ig-like domain, two FnIII domains, a transmembrane domain and an intracellular domain (PMID: 24513123). IL3RA is expressed on hematopoietic progenitor cells, plasmacytoid dendritic cells, basophils, monocytes, some B cells, and in a variety of hematologic malignancies (PMID: 10527461; 34855461). IL-3 initially binds to IL3RA and subsequently recruits the beta chain (CD131) to form the high-affinity receptor, resulting in the activation of a series of signaling pathways including the JAK/STAT, Ras-MAPK, and phosphatidylinositol 3-kinase pathways (PMID: 29296749). IL-3R signaling regulates the proliferation, survival, and differentiation of hematopoietic cells.

Loading...
||
New chat

Able

正在加载,请稍候...