IL3RA/CD123 Recombinant monoclonal antibody, PBS Only (Capture)

IL3RA/CD123 Uni-rAb® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 83243-3-PBS
Clone No.240042E5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Sandwich ELISA, Indirect ELISA, Sample test

IL3RA, 240042E5, CD123, hIL 3Ra, IL 3 receptor subunit alpha

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83243-3-PBS targets IL3RA/CD123 as part of a matched antibody pair:

MP00176-4: 83243-3-PBS capture and 83243-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4452

Product name: Recombinant human IL-3RA protein

Source: e coli.-derived, T-HIS

Tag: 6*His

Domain: 22-305 aa of BC035407

Sequence: DPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWR

Predict reactive species
Full Name interleukin 3 receptor, alpha (low affinity)
Calculated Molecular Weight 378 aa, 43 kDa
Observed Molecular Weight70 kDa
GenBank Accession NumberBC035407
Gene Symbol CD123
Gene ID (NCBI) 3563
ENSEMBL Gene IDENSG00000185291
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP26951
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Interleukin-3 receptor subunit alpha (IL3RA), also known as CD123, belongs to the cytokine receptor family. It is a glycoprotein containing an extracellular domain, involving a predicted Ig-like domain, two FnIII domains, a transmembrane domain and an intracellular domain (PMID: 24513123). IL3RA is expressed on hematopoietic progenitor cells, plasmacytoid dendritic cells, basophils, monocytes, some B cells, and in a variety of hematologic malignancies (PMID: 10527461; 34855461). IL-3 initially binds to IL3RA and subsequently recruits the beta chain (CD131) to form the high-affinity receptor, resulting in the activation of a series of signaling pathways including the JAK/STAT, Ras-MAPK, and phosphatidylinositol 3-kinase pathways (PMID: 29296749). IL-3R signaling regulates the proliferation, survival, and differentiation of hematopoietic cells.

Loading...
||
New chat Able
正在加载,请稍候...