IL-4RA/CD124 Monoclonal antibody, PBS Only (Detector)

IL-4RA/CD124 Monoclonal Antibody for Cytometric bead array, Indirect ELISA
Cat No. 67051-5-PBS
Clone No.1B4D10

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

IL4R, IL 4R subunit alpha, IL 4R alpha, IL 4 receptor subunit alpha, IL 4 binding protein

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67051-5-PBS targets IL-4RA/CD124 as part of a matched antibody pair:

MP50242-3: 67051-3-PBS capture and 67051-5-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28411

Product name: Recombinant human IL-4R protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 26-232 aa of NM_000418

Sequence: MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH

Predict reactive species
Full Name interleukin 4 receptor
Calculated Molecular Weight 90 kDa
GenBank Accession NumberNM_000418
Gene Symbol IL-4R
Gene ID (NCBI) 3566
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP24394
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

IL-4 receptor alpha chain (IL-4RA), also known as CD124, is a transmembrane glycoprotein expressed on a wide variety of hematopoietic and non-hematopoietic cells. It is a receptor for both IL-4 and IL-13. IL-4RA can complex with the common gamma chain (IL-2R gamma or CD132) and utilizes JAK1 and JAK2 for signal transduction, while complexes of IL-4RA with IL-13RA1 subunit mediate signals via JAK2 and Tyk2. The IL-4 response is involved in promoting Th2 differentiation. The IL-4/IL-13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation.

Loading...
||
New chat

Able

正在加载,请稍候...